Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial

In Stock
Code CSB-EP005386TOTa2
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005386TOTa2 could indicate that this peptide derived from E.coli-expressed Tetronarce californica (Pacific electric ray) (Torpedo californica) CHRNA1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005386TOTa2 could indicate that this peptide derived from E.coli-expressed Tetronarce californica (Pacific electric ray) (Torpedo californica) CHRNA1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
CHRNA1Acetylcholine receptor subunit alpha
Species
Tetronarce californica (Pacific electric ray) (Torpedo californica)
Source
E.coli
Expression Region
25-234aa
Target Protein Sequence
SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
40.8kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Recombinant Tetronarce californica CHRNA1 protein is a protein encoded by recombinant DNA that was cloned in an expression vector that supported the expression of CHRNA1 gene. This recombinant CHRNA1 protein was expressed in the host. The expression region is 25-234aa of the Tetronarce californica CHRNA1. In the production, the expression vector contains N-terminal 6xHis-SUMO tag. Every production step was performed with a strict QC system. The purity of this protein is 90%+ determined by SDS-PAGE.

Alpha 1 subunit of nAchRs, which is also called CHRNA1, belongs to muscle type nAchR, different from other neuronal alpha subunits nAchRs. CHRNA1 is detected its expression in NSCLC, and nicotine could activate its downstream MAPK and AKT signaling pathways to induce drug resistance. Additionally, CHRNA1 regulates the binding and gating of acetylcholine neurotransmitters, stood out due to its role in the sympathetic nervous system, which regulates the binding and gating of acetylcholine neurotransmitters, stood out due to its role in the sympathetic nervous system. Previously, dysregulated CHRNA1 levels were found to be associated with multiple neuromuscular disorders, such as congenital myasthenic syndrome, myasthenia gravis, and multiple pterygium syndrome. More importantly, the CHRNA1 gene expression has been found to be significantly higher in the thoracic sympathetic ganglia of patients with hand sweating than normal subjects. Acetylcholine blockers have been used to treat patients with primary focal hyperhidrosis, and the enhanced expression of CHRNA1 gene may be one of the mechanisms underlying excessive sweat secretion. Recently many reports have focused on nAchR inhibitors as target agents for cancer therapy. CHRNA1, a subunit of nAchRs expressed in lung cancer patients, should be the target of cancer therapeutic development for improving the cure rate or for preventing recurrence and prolonging patient survival.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We ordered CSB-EP005386TOTa2, 0.5mg (LOT# 03270) and since our last order went exceptionally well and the protein we received shows promising results, we would like to order more.”
We are interested in 10mg and 25mg for CSB-EP005386TOTa2, please let me know if you can provide a good price for this returned customer. Please also provide me estimated lead time.
Thanks !

A:
Thanks so much for sharing the your feedback with us.
Now we still have 2mg of CSB-EP005386TOTa2 (LOT# 03270) in stock,the lead time for order quantity within 2mg is 3-7 working days
The lead time for 10mg is 20-30 working days and for 25mg is 30-40 working days. And we will also offer you the most reasonable price for bulk order.
Q:

We previously ordered lot# 03270 and lot# 03881 of CSB-EP005386TOTa2, 10mg. Do you have special price for us?
We would like to re-order and need the protein to be provided in lyophilization again, can you guarantee it?

A:
Thanks for your inquiry.
Please remark it's re-order from the lot# 03270 and lot# 03881 when you place the order, we now have 10.9mg of Lot#03881 in stock, but the package size is 1mg*6 vials+0.5mg*9 vials+0.05mg*8 vials.If you can accept this package size, lead time is 3-7 working days if the QC detection result is qualified.
Yes, we can guarantee to provide it in lyophilized form and surely we can offer a special price for you.

Target Background

Function
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*